| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (29 species) not a true protein |
| Species Vibrio vulnificus [TaxId:216895] [226333] (1 PDB entry) |
| Domain d4e0ba2: 4e0b A:146-309 [220128] Other proteins in same PDB: d4e0ba1, d4e0ba3, d4e0bb1, d4e0bb3, d4e0bc1, d4e0bc3, d4e0bd1, d4e0bd3 automated match to d2cmda2 complexed with act |
PDB Entry: 4e0b (more details), 2.17 Å
SCOPe Domain Sequences for d4e0ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e0ba2 d.162.1.0 (A:146-309) automated matches {Vibrio vulnificus [TaxId: 216895]}
vttldvirsetfvaelkgqdpgevrvpvigghsgvtilpllsqvegvefsdeeiaaltkr
iqnagtevveakagggsatlsmgqaacrfglalvkalqgeevieyayvegngehasffaq
pvklgkegveeilpygelsdfekaaldgmletlnsdiqigvdfv
Timeline for d4e0ba2: