Lineage for d4e0ba2 (4e0b A:146-309)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939440Species Vibrio vulnificus [TaxId:216895] [226333] (1 PDB entry)
  8. 1939441Domain d4e0ba2: 4e0b A:146-309 [220128]
    Other proteins in same PDB: d4e0ba1, d4e0bb1, d4e0bc1, d4e0bd1
    automated match to d2cmda2
    complexed with act

Details for d4e0ba2

PDB Entry: 4e0b (more details), 2.17 Å

PDB Description: 2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4e0ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e0ba2 d.162.1.0 (A:146-309) automated matches {Vibrio vulnificus [TaxId: 216895]}
vttldvirsetfvaelkgqdpgevrvpvigghsgvtilpllsqvegvefsdeeiaaltkr
iqnagtevveakagggsatlsmgqaacrfglalvkalqgeevieyayvegngehasffaq
pvklgkegveeilpygelsdfekaaldgmletlnsdiqigvdfv

SCOPe Domain Coordinates for d4e0ba2:

Click to download the PDB-style file with coordinates for d4e0ba2.
(The format of our PDB-style files is described here.)

Timeline for d4e0ba2: