Lineage for d1hwhb2 (1hwh B:131-237)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366778Protein Growth hormone receptor [49280] (1 species)
  7. 366779Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
    tandem of fibronectin type III domains
  8. 366801Domain d1hwhb2: 1hwh B:131-237 [22010]
    Other proteins in same PDB: d1hwha_
    mutant

Details for d1hwhb2

PDB Entry: 1hwh (more details), 2.9 Å

PDB Description: 1:1 complex of human growth hormone mutant g120r with its soluble binding protein

SCOP Domain Sequences for d1hwhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwhb2 b.1.2.1 (B:131-237) Growth hormone receptor {Human (Homo sapiens)}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqms

SCOP Domain Coordinates for d1hwhb2:

Click to download the PDB-style file with coordinates for d1hwhb2.
(The format of our PDB-style files is described here.)

Timeline for d1hwhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwhb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwha_