SCOPe 2.08: Domain d1hwhb2: 1hwh B:131-237

Lineage for d1hwhb2 (1hwh B:131-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
   tandem of fibronectin type III domains

8. Domain d1hwhb2: 1hwh B:131-237 [22010]
   Other proteins in same PDB: d1hwha_
   mutant

Details for d1hwhb2

PDB Entry: 1hwh, 2.9 Å

PDB Description: 1:1 complex of human growth hormone mutant g120r with its soluble binding protein

PDB Compounds: (B:) growth hormone binding protein

SCOPe Domain Sequences for d1hwhb2:

Sequence; same for both SEQRES and ATOM records:

>d1hwhb2 b.1.2.1 (B:131-237) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqms

Timeline for d1hwhb2:

• d1hwhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwhb2 appears in SCOPe 2.07