SCOPe 2.07: Domain d4dvbb2: 4dvb B:109-215

Lineage for d4dvbb2 (4dvb B:109-215)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4dvbb2: 4dvb B:109-215 [220047]
   Other proteins in same PDB: d4dvbb1, d4dvbl1
   automated match to d1tqbc2
   complexed with pg4, so4

Details for d4dvbb2

PDB Entry: 4dvb, 1.93 Å

PDB Description: The crystal structure of the Fab fragment of pro-uPA antibody mAb-112

PDB Compounds: (B:) Fab fragment of pro-uPA antibody mAb-112

SCOPe Domain Sequences for d4dvbb2:

Sequence; same for both SEQRES and ATOM records:

>d4dvbb2 b.1.1.2 (B:109-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4dvbb2:

• d4dvbb2 first appeared in SCOPe 2.03
  
• d4dvbb2 appears in SCOPe 2.06
  
• d4dvbb2 appears in the current release, SCOPe 2.08