Lineage for d4dtja2 (4dtj A:376-901)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2246931Protein Family B DNA polymerase [56680] (7 species)
  7. 2246932Species Bacteriophage RB69 [TaxId:12353] [56681] (92 PDB entries)
  8. 2246938Domain d4dtja2: 4dtj A:376-901 [220020]
    Other proteins in same PDB: d4dtja1
    automated match to d1ig9a2
    protein/DNA complex; complexed with ca, ttp

Details for d4dtja2

PDB Entry: 4dtj (more details), 1.9 Å

PDB Description: RB69 DNA Polymerase Ternary Complex with dTTP Opposite an Abasic Site and ddT/dA as the Penultimate Base-pair
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4dtja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dtja2 e.8.1.1 (A:376-901) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmf

SCOPe Domain Coordinates for d4dtja2:

Click to download the PDB-style file with coordinates for d4dtja2.
(The format of our PDB-style files is described here.)

Timeline for d4dtja2: