Lineage for d4dt2c2 (4dt2 C:121-432)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2231923Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 2231948Protein automated matches [190524] (2 species)
    not a true protein
  7. 2231949Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (6 PDB entries)
  8. 2231970Domain d4dt2c2: 4dt2 C:121-432 [220015]
    Other proteins in same PDB: d4dt2a1, d4dt2b1, d4dt2c1, d4dt2d1
    automated match to d1kbpa2
    complexed with 0lv, act, edo, fe, gol, nag, so4, zn

Details for d4dt2c2

PDB Entry: 4dt2 (more details), 2.7 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment cc27209
PDB Compounds: (C:) purple acid phosphatase

SCOPe Domain Sequences for d4dt2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dt2c2 d.159.1.1 (C:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOPe Domain Coordinates for d4dt2c2:

Click to download the PDB-style file with coordinates for d4dt2c2.
(The format of our PDB-style files is described here.)

Timeline for d4dt2c2: