![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
![]() | Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
![]() | Protein automated matches [227090] (1 species) not a true protein |
![]() | Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (6 PDB entries) |
![]() | Domain d4dt2a1: 4dt2 A:7-120 [220010] Other proteins in same PDB: d4dt2a2, d4dt2b2, d4dt2c2, d4dt2d2 automated match to d2qfra1 complexed with 0lv, act, edo, fe, gol, nag, so4, zn |
PDB Entry: 4dt2 (more details), 2.7 Å
SCOPe Domain Sequences for d4dt2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dt2a1 b.1.12.0 (A:7-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d4dt2a1: