| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
| Protein automated matches [227090] (1 species) not a true protein |
| Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (6 PDB entries) |
| Domain d4dt2b1: 4dt2 B:7-120 [220012] Other proteins in same PDB: d4dt2a2, d4dt2b2, d4dt2c2, d4dt2d2 automated match to d2qfra1 complexed with 0lv, act, edo, fe, gol, nag, so4, zn |
PDB Entry: 4dt2 (more details), 2.7 Å
SCOPe Domain Sequences for d4dt2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dt2b1 b.1.12.0 (B:7-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d4dt2b1: