Lineage for d4dt2a1 (4dt2 A:7-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523538Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 1523557Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 1523558Protein automated matches [227090] (1 species)
    not a true protein
  7. 1523559Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (6 PDB entries)
  8. 1523576Domain d4dt2a1: 4dt2 A:7-120 [220010]
    Other proteins in same PDB: d4dt2a2, d4dt2b2, d4dt2c2, d4dt2d2
    automated match to d2qfra1
    complexed with 0lv, act, edo, fe, gol, nag, so4, zn

Details for d4dt2a1

PDB Entry: 4dt2 (more details), 2.7 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment cc27209
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d4dt2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dt2a1 b.1.12.0 (A:7-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d4dt2a1:

Click to download the PDB-style file with coordinates for d4dt2a1.
(The format of our PDB-style files is described here.)

Timeline for d4dt2a1: