Lineage for d4dsua1 (4dsu A:2-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868129Domain d4dsua1: 4dsu A:2-180 [220001]
    Other proteins in same PDB: d4dsua2
    automated match to d3gftb_
    complexed with bzi, gdp, mg

Details for d4dsua1

PDB Entry: 4dsu (more details), 1.7 Å

PDB Description: Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity
PDB Compounds: (A:) GTPase KRas, isoform 2B

SCOPe Domain Sequences for d4dsua1:

Sequence, based on SEQRES records: (download)

>d4dsua1 c.37.1.8 (A:2-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagq
eeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlp
srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkkk

Sequence, based on observed residues (ATOM records): (download)

>d4dsua1 c.37.1.8 (A:2-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagq
samrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrt
vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkkk

SCOPe Domain Coordinates for d4dsua1:

Click to download the PDB-style file with coordinates for d4dsua1.
(The format of our PDB-style files is described here.)

Timeline for d4dsua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dsua2