Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Growth hormone receptor [49280] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49281] (7 PDB entries) tandem of fibronectin type III domains |
Domain d1hwgb1: 1hwg B:32-130 [21999] Other proteins in same PDB: d1hwga_ |
PDB Entry: 1hwg (more details), 2.5 Å
SCOPe Domain Sequences for d1hwgb1:
Sequence, based on SEQRES records: (download)
>d1hwgb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage nscyfnssftsiwipycikltsnggtvdekcfsvdeivq
>d1hwgb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} epkftkcrsperetfschwtdepiqlfytrrntqewtqewkecpdyvsagenscyfnssf tsiwipycikltsnggtvdekcfsvdeivq
Timeline for d1hwgb1: