Lineage for d1hwgb1 (1hwg B:32-130)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297559Protein Growth hormone receptor [49280] (1 species)
  7. 1297560Species Human (Homo sapiens) [TaxId:9606] [49281] (7 PDB entries)
    tandem of fibronectin type III domains
  8. 1297563Domain d1hwgb1: 1hwg B:32-130 [21999]
    Other proteins in same PDB: d1hwga_

Details for d1hwgb1

PDB Entry: 1hwg (more details), 2.5 Å

PDB Description: 1:2 complex of human growth hormone with its soluble binding protein
PDB Compounds: (B:) growth hormone binding protein

SCOPe Domain Sequences for d1hwgb1:

Sequence, based on SEQRES records: (download)

>d1hwgb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiwipycikltsnggtvdekcfsvdeivq

Sequence, based on observed residues (ATOM records): (download)

>d1hwgb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdepiqlfytrrntqewtqewkecpdyvsagenscyfnssf
tsiwipycikltsnggtvdekcfsvdeivq

SCOPe Domain Coordinates for d1hwgb1:

Click to download the PDB-style file with coordinates for d1hwgb1.
(The format of our PDB-style files is described here.)

Timeline for d1hwgb1: