SCOPe 2.08: Domain d4dqqd1: 4dqq D:293-468

Lineage for d4dqqd1 (4dqq D:293-468)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [226399] (6 PDB entries)

8. Domain d4dqqd1: 4dqq D:293-468 [219952]
   Other proteins in same PDB: d4dqqa2, d4dqqd2
   automated match to d1nk4a1
   protein/DNA complex; complexed with ctp, mes, mg, mpd, so4

Details for d4dqqd1

PDB Entry: 4dqq, 1.59 Å

PDB Description: Ternary complex of Bacillus DNA Polymerase I Large Fragment E658A, DNA duplex, and rCTP (paired with dG of template) in presence of Mg2+

PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d4dqqd1:

Sequence; same for both SEQRES and ATOM records:

>d4dqqd1 c.55.3.0 (D:293-468) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
ekplakmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetal
adpqfvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaa
aakmkqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4dqqd1:

• d4dqqd1 first appeared in SCOPe 2.03
  
• d4dqqd1 appears in SCOPe 2.07