Lineage for d4dqqa1 (4dqq A:297-468)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887264Species Geobacillus kaustophilus [TaxId:235909] [226399] (6 PDB entries)
  8. 2887265Domain d4dqqa1: 4dqq A:297-468 [219950]
    Other proteins in same PDB: d4dqqa2, d4dqqd2
    automated match to d1nk4a1
    protein/DNA complex; complexed with ctp, mes, mg, mpd, so4

Details for d4dqqa1

PDB Entry: 4dqq (more details), 1.59 Å

PDB Description: Ternary complex of Bacillus DNA Polymerase I Large Fragment E658A, DNA duplex, and rCTP (paired with dG of template) in presence of Mg2+
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4dqqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dqqa1 c.55.3.0 (A:297-468) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d4dqqa1:

Click to download the PDB-style file with coordinates for d4dqqa1.
(The format of our PDB-style files is described here.)

Timeline for d4dqqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dqqa2