Lineage for d1tena_ (1ten A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521659Protein Tenascin [49273] (3 species)
  7. 1521665Species Human (Homo sapiens) [TaxId:9606] [49275] (1 PDB entry)
  8. 1521666Domain d1tena_: 1ten A: [21990]
    third Fn3 repeat

Details for d1tena_

PDB Entry: 1ten (more details), 1.8 Å

PDB Description: structure of a fibronectin type iii domain from tenascin phased by mad analysis of the selenomethionyl protein
PDB Compounds: (A:) Tenascin

SCOPe Domain Sequences for d1tena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}
rldapsqievkdvtdttalitwfkplaeidgieltygikdvpgdrttidltedenqysig
nlkpdteyevslisrrgdmssnpaketftt

SCOPe Domain Coordinates for d1tena_:

Click to download the PDB-style file with coordinates for d1tena_.
(The format of our PDB-style files is described here.)

Timeline for d1tena_: