SCOPe 2.08: Domain d1tena_: 1ten A:

Lineage for d1tena_ (1ten A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Tenascin [49273] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49275] (1 PDB entry)

8. Domain d1tena_: 1ten A: [21990]
   third Fn3 repeat

Details for d1tena_

PDB Entry: 1ten, 1.8 Å

PDB Description: structure of a fibronectin type iii domain from tenascin phased by mad analysis of the selenomethionyl protein

PDB Compounds: (A:) Tenascin

SCOPe Domain Sequences for d1tena_:

Sequence; same for both SEQRES and ATOM records:

>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}
rldapsqievkdvtdttalitwfkplaeidgieltygikdvpgdrttidltedenqysig
nlkpdteyevslisrrgdmssnpaketftt

Timeline for d1tena_:

• d1tena_ first appeared (with stable ids) in SCOP 1.55, called d1ten__
  
• d1tena_ appears in SCOPe 2.07