Lineage for d1qr4a2 (1qr4 A:88-175)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521659Protein Tenascin [49273] (3 species)
  7. 1521660Species Chicken (Gallus gallus) [TaxId:9031] [49274] (1 PDB entry)
  8. 1521662Domain d1qr4a2: 1qr4 A:88-175 [21987]
    tandem repeat of two Fn3 modules

Details for d1qr4a2

PDB Entry: 1qr4 (more details), 2.55 Å

PDB Description: two fibronectin type-iii domain segment from chicken tenascin
PDB Compounds: (A:) protein (tenascin)

SCOPe Domain Sequences for d1qr4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}
vgspkgisfsditensatvswtpprsrvdsyrvsyvpitggtpnvvtvdgsktrtklvkl
vpgvdynvniisvkgfeesepisgilkt

SCOPe Domain Coordinates for d1qr4a2:

Click to download the PDB-style file with coordinates for d1qr4a2.
(The format of our PDB-style files is described here.)

Timeline for d1qr4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qr4a1