| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Tenascin [49273] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [49274] (1 PDB entry) |
| Domain d1qr4a2: 1qr4 A:88-175 [21987] tandem repeat of two Fn3 modules |
PDB Entry: 1qr4 (more details), 2.55 Å
SCOPe Domain Sequences for d1qr4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}
vgspkgisfsditensatvswtpprsrvdsyrvsyvpitggtpnvvtvdgsktrtklvkl
vpgvdynvniisvkgfeesepisgilkt
Timeline for d1qr4a2: