SCOPe 2.08: Domain d1qr4a2: 1qr4 A:88-175

Lineage for d1qr4a2 (1qr4 A:88-175)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Tenascin [49273] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49274] (1 PDB entry)

8. Domain d1qr4a2: 1qr4 A:88-175 [21987]
   tandem repeat of two Fn3 modules

Details for d1qr4a2

PDB Entry: 1qr4, 2.55 Å

PDB Description: two fibronectin type-iii domain segment from chicken tenascin

PDB Compounds: (A:) protein (tenascin)

SCOPe Domain Sequences for d1qr4a2:

Sequence; same for both SEQRES and ATOM records:

>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}
vgspkgisfsditensatvswtpprsrvdsyrvsyvpitggtpnvvtvdgsktrtklvkl
vpgvdynvniisvkgfeesepisgilkt

Timeline for d1qr4a2:

• d1qr4a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qr4a2 appears in SCOPe 2.07