Lineage for d4djmc2 (4djm C:153-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045398Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2045482Family b.7.2.0: automated matches [227280] (1 protein)
    not a true family
  6. 2045483Protein automated matches [227091] (2 species)
    not a true protein
  7. 2045484Species Escherichia coli [TaxId:562] [226556] (2 PDB entries)
  8. 2045487Domain d4djmc2: 4djm C:153-213 [219802]
    Other proteins in same PDB: d4djma1, d4djma3, d4djmb1, d4djmb3, d4djmc1, d4djmc3, d4djmd1, d4djmd3, d4djme1, d4djme3, d4djmf1, d4djmf3, d4djmg1, d4djmg3, d4djmh1, d4djmh3
    automated match to d1p5va2

Details for d4djmc2

PDB Entry: 4djm (more details), 2.52 Å

PDB Description: Crystal structure of the E. coli chaperone DraB
PDB Compounds: (C:) DraB

SCOPe Domain Sequences for d4djmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djmc2 b.7.2.0 (C:153-213) automated matches {Escherichia coli [TaxId: 562]}
kgrpddvagkvewqragnrlkgvnptpfyinlstltvggkevkereyiapfssreyplpa
g

SCOPe Domain Coordinates for d4djmc2:

Click to download the PDB-style file with coordinates for d4djmc2.
(The format of our PDB-style files is described here.)

Timeline for d4djmc2: