| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) ![]() |
| Family b.7.2.0: automated matches [227280] (1 protein) not a true family |
| Protein automated matches [227091] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [226556] (2 PDB entries) |
| Domain d4djmc2: 4djm C:153-213 [219802] Other proteins in same PDB: d4djma1, d4djma3, d4djmb1, d4djmb3, d4djmc1, d4djmc3, d4djmd1, d4djmd3, d4djme1, d4djme3, d4djmf1, d4djmf3, d4djmg1, d4djmg3, d4djmh1, d4djmh3 automated match to d1p5va2 |
PDB Entry: 4djm (more details), 2.52 Å
SCOPe Domain Sequences for d4djmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4djmc2 b.7.2.0 (C:153-213) automated matches {Escherichia coli [TaxId: 562]}
kgrpddvagkvewqragnrlkgvnptpfyinlstltvggkevkereyiapfssreyplpa
g
Timeline for d4djmc2: