Lineage for d4dila2 (4dil A:251-398)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587788Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1587789Protein automated matches [190158] (17 species)
    not a true protein
  7. 1587884Species Thermotoga maritima [TaxId:2336] [226499] (2 PDB entries)
  8. 1587887Domain d4dila2: 4dil A:251-398 [219784]
    Other proteins in same PDB: d4dila1, d4dilb1
    automated match to d1vmea1
    complexed with cl, feo; mutant

Details for d4dila2

PDB Entry: 4dil (more details), 2 Å

PDB Description: Flavo Di-iron protein H90N mutant from Thermotoga maritima
PDB Compounds: (A:) Flavoprotein

SCOPe Domain Sequences for d4dila2:

Sequence, based on SEQRES records: (download)

>d4dila2 c.23.5.0 (A:251-398) automated matches {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

Sequence, based on observed residues (ATOM records): (download)

>d4dila2 c.23.5.0 (A:251-398) automated matches {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwtagellketkfrilsftei
kgsnmderkieeaisllkkele

SCOPe Domain Coordinates for d4dila2:

Click to download the PDB-style file with coordinates for d4dila2.
(The format of our PDB-style files is described here.)

Timeline for d4dila2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dila1