SCOPe 2.03: Domain d4dila2: 4dil A:251-398

Lineage for d4dila2 (4dil A:251-398)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (11 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [226499] (2 PDB entries)

8. Domain d4dila2: 4dil A:251-398 [219784]
   Other proteins in same PDB: d4dila1, d4dilb1
   automated match to d1vmea1
   complexed with cl, feo; mutant

Details for d4dila2

PDB Entry: 4dil, 2 Å

PDB Description: Flavo Di-iron protein H90N mutant from Thermotoga maritima

PDB Compounds: (A:) Flavoprotein

SCOPe Domain Sequences for d4dila2:

Sequence, based on SEQRES records:

>d4dila2 c.23.5.0 (A:251-398) automated matches {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

Sequence, based on observed residues (ATOM records):

>d4dila2 c.23.5.0 (A:251-398) automated matches {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwtagellketkfrilsftei
kgsnmderkieeaisllkkele

Timeline for d4dila2:

• d4dila2 is new in SCOPe 2.03-stable
  
• d4dila2 appears in SCOPe 2.04
  
• d4dila2 appears in the current release, SCOPe 2.08