SCOPe 2.08: Domain d4di6b1: 4di6 B:3-169

Lineage for d4di6b1 (4di6 B:3-169)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries)

8. Domain d4di6b1: 4di6 B:3-169 [219774]
   Other proteins in same PDB: d4di6a2, d4di6b2, d4di6d2, d4di6e2, d4di6f2
   automated match to d1xqia1

Details for d4di6b1

PDB Entry: 4di6, 2.4 Å

PDB Description: crystal structure of nucleoside-diphosphate kinase from borrelia burgdorferi

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4di6b1:

Sequence; same for both SEQRES and ATOM records:

>d4di6b1 d.58.6.0 (B:3-169) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivfrh
seavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfkys
nekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc

Timeline for d4di6b1:

• d4di6b1 first appeared in SCOPe 2.03, called d4di6b_
  
• d4di6b1 appears in SCOPe 2.07