Lineage for d4di6b1 (4di6 B:3-169)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2558476Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2558477Protein automated matches [191087] (19 species)
    not a true protein
  7. 2558639Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries)
  8. 2558647Domain d4di6b1: 4di6 B:3-169 [219774]
    Other proteins in same PDB: d4di6a2, d4di6b2, d4di6d2, d4di6e2, d4di6f2
    automated match to d1xqia1

Details for d4di6b1

PDB Entry: 4di6 (more details), 2.4 Å

PDB Description: crystal structure of nucleoside-diphosphate kinase from borrelia burgdorferi
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4di6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4di6b1 d.58.6.0 (B:3-169) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivfrh
seavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfkys
nekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc

SCOPe Domain Coordinates for d4di6b1:

Click to download the PDB-style file with coordinates for d4di6b1.
(The format of our PDB-style files is described here.)

Timeline for d4di6b1: