Lineage for d4dhlc2 (4dhl C:121-430)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440478Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1440508Protein automated matches [190524] (2 species)
    not a true protein
  7. 1440512Species Phaseolus vulgaris [TaxId:3885] [226472] (3 PDB entries)
  8. 1440515Domain d4dhlc2: 4dhl C:121-430 [219764]
    Other proteins in same PDB: d4dhla1, d4dhlb1, d4dhlc1, d4dhld1
    automated match to d1kbpa2
    complexed with 0k7, edo, fe, gol, nag, so4, zn

Details for d4dhlc2

PDB Entry: 4dhl (more details), 2.3 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment mo07123
PDB Compounds: (C:) purple acid phosphatase

SCOPe Domain Sequences for d4dhlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhlc2 d.159.1.1 (C:121-430) automated matches {Phaseolus vulgaris [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvdd

SCOPe Domain Coordinates for d4dhlc2:

Click to download the PDB-style file with coordinates for d4dhlc2.
(The format of our PDB-style files is described here.)

Timeline for d4dhlc2: