SCOPe 2.03: Domain d4dhlb1: 4dhl B:8-120

Lineage for d4dhlb1 (4dhl B:8-120)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species Phaseolus vulgaris [TaxId:3885] [226471] (3 PDB entries)

8. Domain d4dhlb1: 4dhl B:8-120 [219761]
   Other proteins in same PDB: d4dhla2, d4dhlb2, d4dhlc2, d4dhld2
   automated match to d2qfra1
   complexed with 0k7, edo, fe, gol, nag, so4, zn

Details for d4dhlb1

PDB Entry: 4dhl, 2.3 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment mo07123

PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d4dhlb1:

Sequence; same for both SEQRES and ATOM records:

>d4dhlb1 b.1.12.0 (B:8-120) automated matches {Phaseolus vulgaris [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d4dhlb1:

• d4dhlb1 is new in SCOPe 2.03-stable
  
• d4dhlb1 appears in SCOPe 2.04
  
• d4dhlb1 appears in the current release, SCOPe 2.08