Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
Protein automated matches [190524] (2 species) not a true protein |
Species Phaseolus vulgaris [TaxId:3885] [226472] (3 PDB entries) |
Domain d4dhld2: 4dhl D:121-430 [219766] Other proteins in same PDB: d4dhla1, d4dhlb1, d4dhlc1, d4dhld1 automated match to d1kbpa2 complexed with 0k7, edo, fe, gol, nag, so4, zn |
PDB Entry: 4dhl (more details), 2.3 Å
SCOPe Domain Sequences for d4dhld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhld2 d.159.1.1 (D:121-430) automated matches {Phaseolus vulgaris [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvdd
Timeline for d4dhld2: