Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries) |
Domain d4bvha_: 4bvh A: [219558] automated match to d1j8fc_ complexed with ar6, cl, edo, gol, na, oad, ocz, zn |
PDB Entry: 4bvh (more details), 1.9 Å
SCOPe Domain Sequences for d4bvha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bvha_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaif elpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgip asklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpq rfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdv aqlgdvvhgveslvellgwteemrdlvqretg
Timeline for d4bvha_: