SCOPe 2.05: Domain d1dan.1: 1dan T:,U:91-106

Lineage for d1dan.1 (1dan T:,U:91-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
   Uniprot P13726 33-242

8. Domain d1dan.1: 1dan T:,U:91-106 [21953]
   Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3
   complexed with 0z6, bgc, ca, cac, cl, fuc

Details for d1dan.1

PDB Entry: 1dan, 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

PDB Compounds: (T:) soluble tissue factor, (U:) soluble tissue factor

SCOPe Domain Sequences for d1dan.1:

Sequence; same for both SEQRES and ATOM records:

>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypaXeplyenspeftpylet

Timeline for d1dan.1:

• d1dan.1 first appeared (with stable ids) in SCOP 1.55
  
• d1dan.1 appears in SCOPe 2.04
  
• d1dan.1 appears in SCOPe 2.06
  
• d1dan.1 appears in the current release, SCOPe 2.08