![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries) Uniprot P13726 33-242 |
![]() | Domain d1dan.1: 1dan T:,U:91-106 [21953] Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3 complexed with 0z6, bgc, ca, cac, cl, fuc |
PDB Entry: 1dan (more details), 2 Å
SCOPe Domain Sequences for d1dan.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypaXeplyenspeftpylet
Timeline for d1dan.1: