Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (22 proteins) |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries) |
Domain d1dan.1: 1dan T:,U:91-106 [21953] Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3 |
PDB Entry: 1dan (more details), 2 Å
SCOP Domain Sequences for d1dan.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens)} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypaXeplyenspeftpylet
Timeline for d1dan.1: