Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:46170] [226675] (1 PDB entry) |
Domain d4bnqa_: 4bnq A: [219523] automated match to d2j4ee_ complexed with gol, po4 |
PDB Entry: 4bnq (more details), 2.28 Å
SCOPe Domain Sequences for d4bnqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bnqa_ c.51.4.0 (A:) automated matches {Staphylococcus aureus [TaxId: 46170]} keiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakaln ktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvism sgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrna inllqaflegeknv
Timeline for d4bnqa_: