SCOPe 2.03: Domain d4bnqa_: 4bnq A:

Lineage for d4bnqa_ (4bnq A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:46170] [226675] (1 PDB entry)

8. Domain d4bnqa_: 4bnq A: [219523]
   automated match to d2j4ee_
   complexed with gol, po4

Details for d4bnqa_

PDB Entry: 4bnq, 2.28 Å

PDB Description: The structure of the Staphylococcus aureus Ham1 protein

PDB Compounds: (A:) Non-canonical purine NTP pyrophosphatase

SCOPe Domain Sequences for d4bnqa_:

Sequence; same for both SEQRES and ATOM records:

>d4bnqa_ c.51.4.0 (A:) automated matches {Staphylococcus aureus [TaxId: 46170]}
keiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakaln
ktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvism
sgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrna
inllqaflegeknv

Timeline for d4bnqa_:

• d4bnqa_ is new in SCOPe 2.03-stable
  
• d4bnqa_ appears in SCOPe 2.04
  
• d4bnqa_ appears in the current release, SCOPe 2.08