Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.12: Gingipain R (RgpB), C-terminal domain [81292] (1 protein) |
Protein Gingipain R (RgpB), C-terminal domain [49261] (1 species) Arginine-specific cysteine proteinase follows the catalytic alpha/beta domains |
Species Porphyromonas gingivalis [TaxId:837] [49262] (1 PDB entry) |
Domain d1cvra1: 1cvr A:351-432 [21949] Other proteins in same PDB: d1cvra2 complexed with ca, h37, zn |
PDB Entry: 1cvr (more details), 2 Å
SCOPe Domain Sequences for d1cvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvra1 b.1.18.12 (A:351-432) Gingipain R (RgpB), C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} ptemqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade tnltltvvgynkvtvikdvkve
Timeline for d1cvra1: