SCOPe 2.01: Domain d1cvra1: 1cvr A:351-432

Lineage for d1cvra1 (1cvr A:351-432)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.12: Gingipain R (RgpB), C-terminal domain [81292] (1 protein)

6. Protein Gingipain R (RgpB), C-terminal domain [49261] (1 species)
   Arginine-specific cysteine proteinase
   follows the catalytic alpha/beta domains

7. Species Porphyromonas gingivalis [TaxId:837] [49262] (1 PDB entry)

8. Domain d1cvra1: 1cvr A:351-432 [21949]
   Other proteins in same PDB: d1cvra2
   complexed with ca, h37, zn

Details for d1cvra1

PDB Entry: 1cvr, 2 Å

PDB Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)

PDB Compounds: (A:) gingipain r

SCOPe Domain Sequences for d1cvra1:

Sequence; same for both SEQRES and ATOM records:

>d1cvra1 b.1.18.12 (A:351-432) Gingipain R (RgpB), C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
ptemqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkve

Timeline for d1cvra1:

• d1cvra1 first appeared (with stable ids) in SCOP 1.55
  
• d1cvra1 appears in SCOP 1.75
  
• d1cvra1 appears in SCOPe 2.02
  
• d1cvra1 appears in the current release, SCOPe 2.08