Lineage for d1cvra1 (1cvr A:351-432)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Gingipain R (RgpB), C-terminal domain [49261] (1 species) Species Porphyromonas gingivalis [TaxId:837] [49262] (1 PDB entry) 
Domain d1cvra1: 1cvr A:351-432 [21949]
Other proteins in same PDB: d1cvra2
Details for d1cvra1
PDB Entry: 1cvr (more details), 2 Å
PDB Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)
SCOP Domain Sequences for d1cvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvra1 b.1.1.5 (A:351-432) Gingipain R (RgpB), C-terminal domain {Porphyromonas gingivalis}
ptemqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkve
SCOP Domain Coordinates for d1cvra1:
Click to download the PDB-style file with coordinates for d1cvra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cvra1:
- d1cvra1 appears in SCOP 1.57
- d1cvra1 appears in the current release, SCOPe 2.08
View in 3D
