SCOPe 2.08: Domain d4bckd2: 4bck D:309-430

Lineage for d4bckd2 (4bck D:309-430)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein automated matches [227027] (3 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
Domain d4bckd2: 4bck D:309-430 [219425]
Other proteins in same PDB: d4bcka1, d4bcka2, d4bckc1, d4bckc2
automated match to d2cchb2
complexed with sgm, t3e

Details for d4bckd2

PDB Entry: 4bck (more details), 2.05 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4bckd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bckd2 a.74.1.1 (D:309-430) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tl

SCOPe Domain Coordinates for d4bckd2:

Click to download the PDB-style file with coordinates for d4bckd2.
(The format of our PDB-style files is described here.)

Timeline for d4bckd2: