Lineage for d1rama1 (1ram A:192-291)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223263Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
  6. 223279Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 223290Species Mouse (Mus musculus) [TaxId:10090] [49254] (6 PDB entries)
  8. 223298Domain d1rama1: 1ram A:192-291 [21939]
    Other proteins in same PDB: d1rama2, d1ramb2

Details for d1rama1

PDB Entry: 1ram (more details), 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

SCOP Domain Sequences for d1rama1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rama1 b.1.18.1 (A:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOP Domain Coordinates for d1rama1:

Click to download the PDB-style file with coordinates for d1rama1.
(The format of our PDB-style files is described here.)

Timeline for d1rama1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rama2