Lineage for d4ba2i3 (4ba2 I:153-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947088Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species)
  7. 2947095Species Sulfolobus solfataricus [TaxId:2287] [160232] (4 PDB entries)
    Uniprot Q9UXC4 153-221
  8. 2947099Domain d4ba2i3: 4ba2 I:153-231 [219388]
    Other proteins in same PDB: d4ba2a1, d4ba2a2, d4ba2a3, d4ba2b1, d4ba2b2, d4ba2i1, d4ba2i2
    automated match to d2je6i3
    protein/RNA complex; complexed with 1pe, na, po4

Details for d4ba2i3

PDB Entry: 4ba2 (more details), 2.5 Å

PDB Description: Archaeal exosome (Rrp4-Rrp41(D182A)-Rrp42) bound to inorganic phosphate
PDB Compounds: (I:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d4ba2i3:

Sequence, based on SEQRES records: (download)

>d4ba2i3 d.51.1.1 (I:153-231) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair
kieneshikgltdrikqfi

Sequence, based on observed residues (ATOM records): (download)

>d4ba2i3 d.51.1.1 (I:153-231) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvignksmyetltscsifvanngriwatcsrfseeilieairkiene
ltdrikqfi

SCOPe Domain Coordinates for d4ba2i3:

Click to download the PDB-style file with coordinates for d4ba2i3.
(The format of our PDB-style files is described here.)

Timeline for d4ba2i3: