Lineage for d4ba2a2 (4ba2 A:192-275)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967405Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 2967419Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 2967424Domain d4ba2a2: 4ba2 A:192-275 [219383]
    Other proteins in same PDB: d4ba2a1, d4ba2a3, d4ba2b1, d4ba2b2, d4ba2i1, d4ba2i2, d4ba2i3
    automated match to d2je6a2
    protein/RNA complex; complexed with 1pe, na, po4

Details for d4ba2a2

PDB Entry: 4ba2 (more details), 2.5 Å

PDB Description: Archaeal exosome (Rrp4-Rrp41(D182A)-Rrp42) bound to inorganic phosphate
PDB Compounds: (A:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d4ba2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ba2a2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d4ba2a2:

Click to download the PDB-style file with coordinates for d4ba2a2.
(The format of our PDB-style files is described here.)

Timeline for d4ba2a2: