Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
Protein automated matches [191218] (6 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (11 PDB entries) |
Domain d4b3ub_: 4b3u B: [219274] Other proteins in same PDB: d4b3ua2, d4b3uc2 automated match to d3zllb_ complexed with cl, gol, mes, nwl |
PDB Entry: 4b3u (more details), 1.8 Å
SCOPe Domain Sequences for d4b3ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b3ub_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy
Timeline for d4b3ub_: