SCOPe 2.07: Domain d4b3ub_: 4b3u B:

Lineage for d4b3ub_ (4b3u B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
   automatically mapped to Pfam PF00483

6. Protein automated matches [191218] (6 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (11 PDB entries)

8. Domain d4b3ub_: 4b3u B: [219274]
   Other proteins in same PDB: d4b3ua2, d4b3uc2
   automated match to d3zllb_
   complexed with cl, gol, mes, nwl

Details for d4b3ub_

PDB Entry: 4b3u, 1.8 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor

PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4b3ub_:

Sequence; same for both SEQRES and ATOM records:

>d4b3ub_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

Timeline for d4b3ub_:

• d4b3ub_ first appeared in SCOPe 2.03
  
• d4b3ub_ appears in SCOPe 2.06
  
• d4b3ub_ appears in the current release, SCOPe 2.08