SCOPe 2.05: Domain d4b3aa1: 4b3a A:2-67

Lineage for d4b3aa1 (4b3a A:2-67)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226228] (7 PDB entries)

8. Domain d4b3aa1: 4b3a A:2-67 [219259]
   Other proteins in same PDB: d4b3aa2
   automated match to d1qpia1
   complexed with cl, mg, tac; mutant

Details for d4b3aa1

PDB Entry: 4b3a, 1.7 Å

PDB Description: tetracycline repressor class d mutant h100a in complex with tetracycline

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4b3aa1:

Sequence; same for both SEQRES and ATOM records:

>d4b3aa1 a.4.1.0 (A:2-67) automated matches {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d4b3aa1:

• d4b3aa1 first appeared in SCOPe 2.03
  
• d4b3aa1 appears in SCOPe 2.04
  
• d4b3aa1 appears in SCOPe 2.06
  
• d4b3aa1 appears in the current release, SCOPe 2.08