| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (11 species) not a true protein |
| Species Escherichia coli [TaxId:562] [226228] (4 PDB entries) |
| Domain d4b3aa1: 4b3a A:2-67 [219259] Other proteins in same PDB: d4b3aa2 automated match to d1qpia1 complexed with cl, mg, tac; mutant |
PDB Entry: 4b3a (more details), 1.7 Å
SCOPe Domain Sequences for d4b3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b3aa1 a.4.1.0 (A:2-67) automated matches {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys
Timeline for d4b3aa1: