Lineage for d4ay4b_ (4ay4 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465445Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2465561Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 2465562Protein automated matches [190879] (8 species)
    not a true protein
  7. 2465563Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226812] (3 PDB entries)
  8. 2465569Domain d4ay4b_: 4ay4 B: [219210]
    automated match to d3rg8c_
    complexed with act

Details for d4ay4b_

PDB Entry: 4ay4 (more details), 2 Å

PDB Description: crystal structure of Bacillus anthracis PurE
PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d4ay4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ay4b_ c.23.8.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvregsel

SCOPe Domain Coordinates for d4ay4b_:

Click to download the PDB-style file with coordinates for d4ay4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ay4b_: