SCOPe 2.06: Domain d4ay4b_: 4ay4 B:

Lineage for d4ay4b_ (4ay4 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.0: automated matches [191522] (1 protein)
   not a true family

6. Protein automated matches [190879] (8 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226812] (3 PDB entries)

8. Domain d4ay4b_: 4ay4 B: [219210]
   automated match to d3rg8c_
   complexed with act

Details for d4ay4b_

PDB Entry: 4ay4, 2 Å

PDB Description: crystal structure of Bacillus anthracis PurE

PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d4ay4b_:

Sequence; same for both SEQRES and ATOM records:

>d4ay4b_ c.23.8.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvregsel

Timeline for d4ay4b_:

• d4ay4b_ first appeared in SCOPe 2.03
  
• d4ay4b_ appears in SCOPe 2.05
  
• d4ay4b_ appears in SCOPe 2.07
  
• d4ay4b_ appears in the current release, SCOPe 2.08