Lineage for d1evub1 (1evu B:8-190)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105192Protein Transglutaminase N-terminal domain [49235] (2 species)
  7. 105193Species Human (Homo sapiens) [TaxId:9606] [49236] (7 PDB entries)
  8. 105197Domain d1evub1: 1evu B:8-190 [21884]
    Other proteins in same PDB: d1evua2, d1evua3, d1evua4, d1evub2, d1evub3, d1evub4

Details for d1evub1

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1evub1:

Sequence, based on SEQRES records: (download)

>d1evub1 b.1.1.5 (B:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens)}
fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
ced

Sequence, based on observed residues (ATOM records): (download)

>d1evub1 b.1.1.5 (B:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens)}
fggrravppnnsnaaeddlptvelqgvvqeflnvtsvhlfkerwdtnkvdhhtdkyennk
livrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgak
ivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOP Domain Coordinates for d1evub1:

Click to download the PDB-style file with coordinates for d1evub1.
(The format of our PDB-style files is described here.)

Timeline for d1evub1: