Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [226803] (3 PDB entries) |
Domain d4af7a1: 4af7 A:13-148 [218824] Other proteins in same PDB: d4af7a2, d4af7b2 automated match to d1frna1 complexed with fad; mutant |
PDB Entry: 4af7 (more details), 2.85 Å
SCOPe Domain Sequences for d4af7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4af7a1 b.43.4.0 (A:13-148) automated matches {Pea (Pisum sativum) [TaxId: 3888]} hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd lkpgsevkitgpvgke
Timeline for d4af7a1: