Lineage for d4af7a1 (4af7 A:13-148)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793765Species Pea (Pisum sativum) [TaxId:3888] [226803] (3 PDB entries)
  8. 2793766Domain d4af7a1: 4af7 A:13-148 [218824]
    Other proteins in same PDB: d4af7a2, d4af7b2
    automated match to d1frna1
    complexed with fad; mutant

Details for d4af7a1

PDB Entry: 4af7 (more details), 2.85 Å

PDB Description: pea fnr c266m mutant
PDB Compounds: (A:) Ferredoxin--NADP reductase, leaf isozyme, chloroplastic

SCOPe Domain Sequences for d4af7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4af7a1 b.43.4.0 (A:13-148) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd
lkpgsevkitgpvgke

SCOPe Domain Coordinates for d4af7a1:

Click to download the PDB-style file with coordinates for d4af7a1.
(The format of our PDB-style files is described here.)

Timeline for d4af7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4af7a2