SCOP 1.71: Domain d1eiba1: 1eib A:24-132

Lineage for d1eiba1 (1eib A:24-132)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Chitinase A, N-terminal domain N [49233] (1 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Serratia marcescens [TaxId:615] [49234] (9 PDB entries)

8. Domain d1eiba1: 1eib A:24-132 [21874]
   Other proteins in same PDB: d1eiba2, d1eiba3
   complexed with nag; mutant

Details for d1eiba1

PDB Entry: 1eib, 1.8 Å

PDB Description: crystal structure of chitinase a mutant d313a complexed with octa-n- acetylchitooctaose (nag)8.

SCOP Domain Sequences for d1eiba1:

Sequence; same for both SEQRES and ATOM records:

>d1eiba1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

Timeline for d1eiba1:

• d1eiba1 first appeared (with stable ids) in SCOP 1.55
  
• d1eiba1 appears in SCOP 1.69
  
• d1eiba1 appears in SCOP 1.73
  
• d1eiba1 appears in the current release, SCOPe 2.08