Lineage for d1eiba1 (1eib A:24-132)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9610Protein Chitinase A, N-terminal domain [49233] (1 species)
  7. 9611Species Serratia marcescens [TaxId:615] [49234] (4 PDB entries)
  8. 9613Domain d1eiba1: 1eib A:24-132 [21874]
    Other proteins in same PDB: d1eiba2, d1eiba3

Details for d1eiba1

PDB Entry: 1eib (more details), 1.8 Å

PDB Description: crystal structure of chitinase a mutant d313a complexed with octa-n-acetylchitooctaose (nag)8.
PDB Compounds: (A:)

SCOP Domain Sequences for d1eiba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiba1 b.1.1.5 (A:24-132) Chitinase A, N-terminal domain {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1eiba1:

Click to download the PDB-style file with coordinates for d1eiba1.
(The format of our PDB-style files is described here.)

Timeline for d1eiba1: